PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621085.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 315aa    MW: 36413.4 Da    PI: 6.8636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621085.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.3e-182572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
   XP_009621085.1 25 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 72
                     89********************************************97 PP

2Myb_DNA-binding51.32.6e-1678121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009621085.1  78 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7442072IPR017930Myb domain
SuperFamilySSF466891.16E-3022119IPR009057Homeodomain-like
SMARTSM007175.1E-152474IPR001005SANT/Myb domain
PfamPF002494.9E-162572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-222679IPR009057Homeodomain-like
CDDcd001671.46E-112772No hitNo description
PROSITE profilePS5129423.24673127IPR017930Myb domain
SMARTSM007171.3E-1477125IPR001005SANT/Myb domain
PfamPF002495.3E-1578121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2380126IPR009057Homeodomain-like
CDDcd001673.54E-798121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDHNKIKVGF KNNNQEREED LDLRRGPWTV EEDFTLINFI AHHGEGRWNS LARCAGLKRT  60
GKSCRLRWLN YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHAKQL KCDVNSKQFK DTMKYLWMPR LVERIQAAAA TSGTTVASSS TTTYIQNQEN  180
QQPLPNISTM SEVNVPVQLT NNVDKTNGLN YSSTIFTLEN SSTTASSDNS SSDLTDCCYN  240
FPINQSVNQD YVQVNQSNQV CYGDQYLTSP TGYFNPGYFQ ALDQQNSHQL MDGEYGSDNS  300
WNIEDVWFLQ QQFNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242211924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621085.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016479574.10.0PREDICTED: transcription factor MYB108-like
TrEMBLK4C2131e-147K4C213_SOLLC; Uncharacterized protein
STRINGSolyc05g053330.2.11e-146(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.19e-86myb domain protein 78